DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cbx8

DIOPT Version :10

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001072443.1 Gene:cbx8 / 779897 XenbaseID:XB-GENE-977527 Length:362 Species:Xenopus tropicalis


Alignment Length:69 Identity:27/69 - (39%)
Similarity:41/69 - (59%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAK-----SKKRGE 67
            |..|.::.:|| .:|::||.:||:|::...:|||||||.....|:..||:...:     .|||| 
 Frog    11 FAAESLLKRRI-RKGRMEYLVKWKGWSQKYSTWEPEENILDARLVAAFEDREREREMYGPKKRG- 73

  Fly    68 KKPK 71
            .|||
 Frog    74 PKPK 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 18/46 (39%)
CSD 85..135 CDD:349275
cbx8NP_001072443.1 CD_Cbx6 8..65 CDD:349295 20/54 (37%)
CBX7_C <332..354 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.