DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cdyl

DIOPT Version :10

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_696879.5 Gene:cdyl / 568457 ZFINID:ZDB-GENE-070912-561 Length:581 Species:Danio rerio


Alignment Length:67 Identity:26/67 - (38%)
Similarity:39/67 - (58%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKNEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEEN-CDCPNLIQKFEESRAKSKK 64
            |:..|..:.||||:.||...:||.||.::||||:...:|||||.: ..|...|.:|....::.:|
Zfish     1 MMATEELYEVERIIGKRKNKKGKTEYLVRWRGYSFEGDTWEPEGHLSSCIEFIHEFNRQHSEKQK 65

  Fly    65 RG 66
            .|
Zfish    66 DG 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 21/47 (45%)
CSD 85..135 CDD:349275
cdylXP_696879.5 CD_CDY 7..58 CDD:349284 22/50 (44%)
Herpes_BLLF1 <73..297 CDD:282904
crotonase-like 327..523 CDD:119339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.