DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cdyl

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_696879.5 Gene:cdyl / 568457 ZFINID:ZDB-GENE-070912-561 Length:581 Species:Danio rerio


Alignment Length:67 Identity:26/67 - (38%)
Similarity:39/67 - (58%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKNEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEEN-CDCPNLIQKFEESRAKSKK 64
            |:..|..:.||||:.||...:||.||.::||||:...:|||||.: ..|...|.:|....::.:|
Zfish     1 MMATEELYEVERIIGKRKNKKGKTEYLVRWRGYSFEGDTWEPEGHLSSCIEFIHEFNRQHSEKQK 65

  Fly    65 RG 66
            .|
Zfish    66 DG 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 22/49 (45%)
Chromo_shadow 89..134 CDD:279701
cdylXP_696879.5 CHROMO 8..61 CDD:214605 22/52 (42%)
crotonase-like 327..523 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R201
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.