DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cbx3b

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001373276.1 Gene:cbx3b / 567497 ZFINID:ZDB-GENE-070628-2 Length:194 Species:Danio rerio


Alignment Length:180 Identity:57/180 - (31%)
Similarity:91/180 - (50%) Gaps:51/180 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKNE--------PNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKF--- 55
            |||.        ..|.||:|:.:|: :.||||||:||:|:|.|:||||||:|.|||.||:::   
Zfish     7 VKNRKAEETTVVQEFAVEKIIRRRV-NNGKVEYYLKWKGFTDAENTWEPEDNLDCPELIEEYLRN 70

  Fly    56 --------EESRAKSKKRGEKKPKCEEIQKLRG-----------YERGLELAE------------ 89
                    |:...:|... |.:|| ||:.:|..           .||..|..|            
Zfish    71 LTVLGQETEQEECQSLDH-EVQPK-EELSELAADMAHQQPQEELIERTNEEVEEHNAEIPVGQPG 133

  Fly    90 ------IVGATDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQ 133
                  |:|.||..|::.:|::|:..||..|:.:.:..::.|||:|.:::
Zfish   134 HPEPDCIIGCTDQQGELMFLIKWKNTDEVALLAAVEASKRWPQMVIRFYE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 28/59 (47%)
Chromo_shadow 89..134 CDD:279701 15/63 (24%)
cbx3bNP_001373276.1 CD_CSD 20..68 CDD:421697 28/48 (58%)
Chromo_shadow 136..188 CDD:396116 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.