DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cbx5

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001073653.1 Gene:cbx5 / 563396 ZFINID:ZDB-GENE-030131-5553 Length:204 Species:Danio rerio


Alignment Length:173 Identity:61/173 - (35%)
Similarity:93/173 - (53%) Gaps:45/173 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKF------------- 55
            :|..:|||:::|:|:. :|:|||::||:|:|...||||||:|.|||.||.:|             
Zfish    17 DEEEYVVEKVLDRRVV-KGRVEYFLKWKGFTEKHNTWEPEKNLDCPELISEFMKTYKKGNSASPP 80

  Fly    56 -----------------------------EESRAKSKKRGEKKPKCEEIQKLRGYERGLELAEIV 91
                                         ||....|.|  .||.|.:||...||:|||||..:|:
Zfish    81 SSKSSSTGPSSARPKDSSGSSSTSKRKNSEEENGSSSK--PKKKKEDEILVARGFERGLEPEKII 143

  Fly    92 GATDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQK 134
            ||||..||:.:|::|:..||.|||.:.:...|.||::|.::::
Zfish   144 GATDSCGDLMFLMKWKDSDEADLVLAKEANHKCPQIVIAFYEE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 27/90 (30%)
Chromo_shadow 89..134 CDD:279701 18/44 (41%)
cbx5NP_001073653.1 Chromo 21..69 CDD:306815 26/48 (54%)
Chromo_shadow 138..190 CDD:307518 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8756
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.