powered by:
Protein Alignment HP1c and mphosph8
DIOPT Version :9
Sequence 1: | NP_651093.1 |
Gene: | HP1c / 42696 |
FlyBaseID: | FBgn0039019 |
Length: | 237 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001119905.1 |
Gene: | mphosph8 / 504061 |
ZFINID: | ZDB-GENE-050309-191 |
Length: | 946 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 28/70 - (40%) |
Similarity: | 44/70 - (62%) |
Gaps: | 8/70 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 EPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENC-DCPNLIQKFEESRAKSKKRGEK 68
|..:.||||:|.|: .||:|.|.::|:.|:|.|:|||||.:. ||..::..::::.| |.
Zfish 18 EDVYEVERIIDVRV-EEGEVLYRVRWKNYSSEDDTWEPEAHLDDCKEVLLAYKKALA------EL 75
Fly 69 KPKCE 73
|||.|
Zfish 76 KPKKE 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.