DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and mphosph8

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001119905.1 Gene:mphosph8 / 504061 ZFINID:ZDB-GENE-050309-191 Length:946 Species:Danio rerio


Alignment Length:70 Identity:28/70 - (40%)
Similarity:44/70 - (62%) Gaps:8/70 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENC-DCPNLIQKFEESRAKSKKRGEK 68
            |..:.||||:|.|: .||:|.|.::|:.|:|.|:|||||.:. ||..::..::::.|      |.
Zfish    18 EDVYEVERIIDVRV-EEGEVLYRVRWKNYSSEDDTWEPEAHLDDCKEVLLAYKKALA------EL 75

  Fly    69 KPKCE 73
            |||.|
Zfish    76 KPKKE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 21/49 (43%)
Chromo_shadow 89..134 CDD:279701
mphosph8NP_001119905.1 CHROMO 20..70 CDD:214605 21/50 (42%)
ANK repeat 654..684 CDD:293786
ANK 681..805 CDD:238125
Ank_2 693..781 CDD:289560
ANK repeat 719..750 CDD:293786
ANK repeat 752..781 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.