DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and Cbx6

DIOPT Version :10

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_083039.2 Gene:Cbx6 / 494448 MGIID:3512628 Length:414 Species:Mus musculus


Alignment Length:116 Identity:36/116 - (31%)
Similarity:53/116 - (45%) Gaps:28/116 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAK-----SKKRGE 67
            |..|.|:.:|| .:|::||.:||:|:....:|||||||.....||..||:...:     .|||| 
Mouse    11 FAAESIIKRRI-RKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRG- 73

  Fly    68 KKPKCEEIQKLRGYERGLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSA 118
            .||| ..:.|.|.....|.::::                    .|.:.|||
Mouse    74 PKPK-TFLLKARAQAEALRISDV--------------------HFSVKPSA 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 20/46 (43%)
CSD 85..135 CDD:349275 5/34 (15%)
Cbx6NP_083039.2 CD_Cbx6 8..65 CDD:349295 22/54 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..152
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..308
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..365
CBX7_C 359..390 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.