DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and rhi

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster


Alignment Length:272 Identity:59/272 - (21%)
Similarity:104/272 - (38%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKNEPN-----FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENC-DCPNLIQKFE--- 56
            :|...||     :|||:|:.||..: |:.:..:||.|:.:.:|||||.||. :|..|:..||   
  Fly    12 LVDAPPNDHVEEYVVEKILGKRFVN-GRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEV 75

  Fly    57 -----ESRAKSKKRGEKKPKC----------EEIQKLRGYERGLELAEIVGATDV---------- 96
                 ::.|||..:.:..|..          ...:|.:.:.:.::.....|.:.:          
  Fly    76 FRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKK 140

  Fly    97 -TGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQKMAPYSRHIAMRMKGVPEELRLAASRT 160
             .|.||.:..:....    :||...|..|...:.|........:...:.|::.:..:|.| ...|
  Fly   141 TAGKIKDIENYPKTQ----MPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNL-IEPT 200

  Fly   161 SYPHISSAPVEVPPEVDQSAELAGHLGGIAPQVDQAP---QHHAPM----------DLANDTDDL 212
            ....:....::.||:..:..|.        ||.:.||   :|.:||          ....|..||
  Fly   201 KDKDVGDTSLKTPPKSRRLIEF--------PQREDAPLSSKHVSPMLIRKESQPLQSSCTDDSDL 257

  Fly   213 ASVSYSIPVPGV 224
            ...|.|:.:|.|
  Fly   258 GESSSSMSLPTV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 21/57 (37%)
Chromo_shadow 89..134 CDD:279701 9/55 (16%)
rhiNP_536794.1 CHROMO 22..72 CDD:237991 19/50 (38%)
ChSh 357..411 CDD:294039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.