DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cbx7

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001005071.1 Gene:cbx7 / 448638 XenbaseID:XB-GENE-942584 Length:245 Species:Xenopus tropicalis


Alignment Length:86 Identity:35/86 - (40%)
Similarity:47/86 - (54%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAKSKKRGEKK 69
            |..|.||.|..||| .:|||||.:||:|:....:||||||:...|.|:..:||...|.:..|.:|
 Frog     8 EQVFAVESIRKKRI-RKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVLAYEEKEEKERASGCRK 71

  Fly    70 --PKCEEIQKLRGYERGLELA 88
              ||.:.:...|.|...|..|
 Frog    72 RGPKPKRLLLQRLYSMDLRSA 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 23/48 (48%)
Chromo_shadow 89..134 CDD:279701 35/86 (41%)
cbx7NP_001005071.1 CD_Cbx7 7..62 CDD:349293 26/54 (48%)
CBX7_C 202..234 CDD:375056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.