DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and Oxp

DIOPT Version :10

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster


Alignment Length:60 Identity:23/60 - (38%)
Similarity:32/60 - (53%) Gaps:7/60 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENC-DCPNLI-----QKFEESRAK 61
            ::||:.:.||.. .|:.:|..||.||.....||||.||. .|..||     :.|::||.|
  Fly    22 YIVEKFLGKRYL-RGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 19/52 (37%)
CSD 85..135 CDD:349275
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.