DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and Cbx1

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_006247295.1 Gene:Cbx1 / 360609 RGDID:1310714 Length:193 Species:Rattus norvegicus


Alignment Length:160 Identity:61/160 - (38%)
Similarity:101/160 - (63%) Gaps:29/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESR-------- 59
            :.|..:|||:::|:|:. :|||||.:||:|::..|||||||||.|||:||.:|.:|:        
  Rat    16 EEEEEYVVEKVLDRRVV-KGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDK 79

  Fly    60 ---------AKSKKRGEK-KPKCE----------EIQKLRGYERGLELAEIVGATDVTGDIKYLV 104
                     :.|:.:||: |||.:          :.:|.||:.||||...|:||||.:|::.:|:
  Rat    80 SDGGKRKADSDSEDKGEESKPKKKKEEALPIWFLQSEKPRGFARGLEPERIIGATDSSGELMFLM 144

  Fly   105 RWQFCDEFDLVPSAQIVEKDPQMLIDYFQK 134
            :|:..||.||||:.:...|.||::|.::::
  Rat   145 KWKNSDEADLVPAKEANVKCPQVVISFYEE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 28/48 (58%)
Chromo_shadow 89..134 CDD:279701 18/44 (41%)
Cbx1XP_006247295.1 Chromo 27..70 CDD:278797 25/43 (58%)
Chromo_shadow 126..177 CDD:279701 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.