DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HP1c and HP6

DIOPT Version :9

Sequence 1:	NP_651093.1	Gene:	HP1c / 42696	FlyBaseID:	FBgn0039019	Length:	237	Species:	Drosophila melanogaster
Sequence 2:	NP_608842.1	Gene:	HP6 / 33661	FlyBaseID:	FBgn0031613	Length:	106	Species:	Drosophila melanogaster

Alignment Length:	79	Identity:	25/79 - (31%)
Similarity:	45/79 - (56%)	Gaps:	6/79 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    75 IQKLRGYERGLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQKMAPYS 139
            :::..|::.|||...|:||.:.:|.:.:|::|:.|||..|||:..:..:.|||:|.:      |.
  Fly    14 VKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISF------YE 72

  Fly   140 RHIAMRMKGVPEEL 153
            ..|....:|..|:|
  Fly    73 ERIVFTDEGDEEDL 86

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HP1c	NP_651093.1	Chromo	9..58	CDD:278797
HP1c	NP_651093.1	Chromo_shadow	89..134	CDD:279701	16/44 (36%)
HP6	NP_608842.1	Chromo_shadow	25..76	CDD:279701	18/56 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1911
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR22812
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	5	4.920