DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cbx2

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_919354.1 Gene:cbx2 / 327291 ZFINID:ZDB-GENE-030131-5502 Length:510 Species:Danio rerio


Alignment Length:318 Identity:70/318 - (22%)
Similarity:115/318 - (36%) Gaps:120/318 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKF----EESRAKSKKR 65
            |..|..|.|::|| |.:||:||.:||||::|..|:|||:||...|.|:..|    :|......|:
Zfish     9 EQVFDAECILNKR-TRKGKLEYLVKWRGWSSKHNSWEPQENLLDPRLLVAFNKREQEKELLISKK 72

  Fly    66 GEKKPKCEEIQKLRGYERG-LELAEIV-----------------------GATDVTGDIKYLVRW 106
            | |:|        ||..|. :|...:|                       .:||...:       
Zfish    73 G-KRP--------RGRPRKIMETIPVVSKSSSSSSSSSSSGSSSSSSSSSSSTDDDDE------- 121

  Fly   107 QFCDEFDLVP---------------SAQIVEKDP------------------QMLIDYFQKMAPY 138
               |:.::.|               .||||...|                  :.:....:.:.|.
Zfish   122 ---DDHNMTPKPIPRPREHLPVPQKKAQIVVAKPGPPKKRGRKALPPELKAIRQVKGTRKILKPI 183

  Fly   139 SRHIAMRMKGVPEELRLAA------------------SRTSYPHISSAPVEVPPEVDQSAELAGH 185
            ||...:|  |:.:.|..|:                  :|.|:.|.||.           :.|...
Zfish   184 SRDSDLR--GIKKPLMPASFTYTGLNRTSGREPMAMHNRGSFTHKSSL-----------SSLGRS 235

  Fly   186 LGGIA--PQVDQAPQHHAPMDLANDTDDLAS-VSYSIPV---PGVGDIAIDVPMAENQ 237
            :|.::  |.::::||..:..|......|:.| :....|.   |||.  |:::..:..|
Zfish   236 IGSVSSPPTLNRSPQTKSASDFKLSVSDMNSGLDPKTPTCKSPGVA--ALNLHSSNGQ 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 23/52 (44%)
Chromo_shadow 89..134 CDD:279701 10/100 (10%)
cbx2NP_919354.1 Chromo 15..61 CDD:278797 23/46 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.