DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and Cbx8

DIOPT Version :10

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_038954.1 Gene:Cbx8 / 30951 MGIID:1353589 Length:362 Species:Mus musculus


Alignment Length:284 Identity:71/284 - (25%)
Similarity:103/284 - (36%) Gaps:104/284 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAK-----SKKRGE 67
            |..|.::.:|| .:|::||.:||:|::...:|||||||.....|:..|||...:     .||||.
Mouse    11 FAAEALLKRRI-RKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGP 74

  Fly    68 KKP----KCEEIQKLRGYE------RGLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSAQIVE 122
            |..    |.:...|.:.||      ||:.             |.|             |.     
Mouse    75 KPKTFLLKAQAKAKAKTYEFRSDSTRGIR-------------IPY-------------PG----- 108

  Fly   123 KDPQMLIDYFQKMAPYSR-HIAMRMKGVP------------------EELRLAASRT----SYPH 164
            :.|       |.:|..|| ...:|..|:|                  .|.....||.    |.|.
Mouse   109 RSP-------QDLASTSRAREGLRNTGLPPPGSSTSTCRADPPRDRDRERDRGTSRVDDKPSSPG 166

  Fly   165 ISS-----APVEVP------PEVDQSAELAGHLGGIAPQVDQA-------PQHHAPMDLANDTD- 210
            .||     .|.:.|      |..:.||.|..:|.|  .::|:.       |..|:.:.||...| 
Mouse   167 DSSKKRGPKPRKEPLDPSQRPLGEPSAGLGEYLKG--RKLDETSSGTGKFPAGHSVIQLARRQDS 229

  Fly   211 DLASVSYSIPVPGVGD----IAID 230
            ||  |.|.:..|...:    :|:|
Mouse   230 DL--VQYGVTSPSSAEASSKLAVD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 18/46 (39%)
CSD 85..135 CDD:349275 5/49 (10%)
Cbx8NP_038954.1 CD_polycomb_like 11..59 CDD:349277 19/48 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..197 28/144 (19%)
CBX7_C 322..354 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.