DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and Cbx3

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001008314.2 Gene:Cbx3 / 297093 RGDID:1549705 Length:183 Species:Rattus norvegicus


Alignment Length:146 Identity:63/146 - (43%)
Similarity:95/146 - (65%) Gaps:17/146 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EP-NFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEES-RAKSKKRGE 67
            || .||||:::|:|:.: |||||::||:|:|.||||||||||.|||.||:.|..| :|..:|.|.
  Rat    26 EPEEFVVEKVLDRRVVN-GKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGT 89

  Fly    68 K--------------KPKCEEIQKLRGYERGLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSA 118
            |              |.|.:...|.||:.|||:...|:||||.:|::.:|::|:..||.|||.:.
  Rat    90 KRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAK 154

  Fly   119 QIVEKDPQMLIDYFQK 134
            :...|.||::|.::::
  Rat   155 EANMKCPQIVIAFYEE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 30/48 (63%)
Chromo_shadow 89..134 CDD:279701 17/44 (39%)
Cbx3NP_001008314.2 CD_HP1gamma_Cbx3 29..78 CDD:349299 31/49 (63%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336694
Domainoid 1 1.000 78 1.000 Domainoid score I8568
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.