DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and Cdyl2

DIOPT Version :10

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_017456726.1 Gene:Cdyl2 / 292044 RGDID:1309548 Length:551 Species:Rattus norvegicus


Alignment Length:68 Identity:29/68 - (42%)
Similarity:41/68 - (60%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEEN-CDCPNLIQKF------EESRAKS-KKRG 66
            ||||:|||...:||.||.|:|:||.|.::|||||.: ..|...|.:|      ::.:.|| |:.|
  Rat    57 VERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHLPKDKKVKSGKQAG 121

  Fly    67 EKK 69
            ..|
  Rat   122 ASK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 23/45 (51%)
CSD 85..135 CDD:349275
Cdyl2XP_017456726.1 CD_CDY 57..105 CDD:349284 24/47 (51%)
crotonase-like 297..493 CDD:119339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.