DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and Mphosph8

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001017375.2 Gene:Mphosph8 / 290270 RGDID:1305133 Length:851 Species:Rattus norvegicus


Alignment Length:98 Identity:36/98 - (36%)
Similarity:54/98 - (55%) Gaps:9/98 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENC-DCPNLIQKFEESRAKSKKRGEK 68
            |..|.||||:|.:... ||..|.::|:||||.|:|||||.:. ||..::.:|.:..|::|.:..:
  Rat    56 EDVFEVERILDMKCEG-GKNLYKVRWKGYTSDDDTWEPEVHLEDCKEVLLEFRKKVAENKAKAVR 119

  Fly    69 KPKCEEIQKLRGYERGLELAEIVGATDVTGDIK 101
            |    :||||   ....::.|.....|..||.|
  Rat   120 K----DIQKL---SLNNDIFEADSDIDQQGDTK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 22/49 (45%)
Chromo_shadow 89..134 CDD:279701 5/13 (38%)
Mphosph8NP_001017375.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..54
CHROMO 58..109 CDD:214605 23/51 (45%)
Histone H3K9me3 binding. /evidence=ECO:0000250|UniProtKB:Q99549 80..87 5/6 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..174 5/13 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..302
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..428
ANK 586..710 CDD:238125
ANK 1 591..620
ANK repeat 594..622 CDD:293786
Ank_2 597..686 CDD:289560
ANK repeat 624..655 CDD:293786
ANK 2 624..653
ANK repeat 657..686 CDD:293786
ANK 3 657..686
ANK 4 690..719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.