DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and chp1

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_593666.1 Gene:chp1 / 2542239 PomBaseID:SPAC18G6.02c Length:960 Species:Schizosaccharomyces pombe


Alignment Length:318 Identity:74/318 - (23%)
Similarity:117/318 - (36%) Gaps:120/318 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEEN----------------CDCPNLIQKF- 55
            :.||.|:..|:...|..||||||.||...|||||||:|                .....|::.| 
pombe    22 YEVEDILADRVNKNGINEYYIKWAGYDWYDNTWEPEQNLFGAEKVLKKWKKRKKLIAKGLLEPFD 86

  Fly    56 -EESRAKSKKRGEKKPKCEEIQKLRGYERGLELAEIVGATDVTGDIKYLVRWQFCDEFDLV---P 116
             |::.||..|| ||     ||.:.:..:|..||      |.::..:|        ::|..:   |
pombe    87 AEDNEAKKMKR-EK-----EILRQQRQKRKSEL------TQLSQKVK--------EKFKKMRKKP 131

  Fly   117 SAQIV--------EKDPQMLIDYFQKMAPYSRHIAMRMKGVPEELRLAASRTS------------ 161
            :.:||        |.|..|..|.|::.:         |:|..:|..| ..:||            
pombe   132 ARRIVTIANDEEEEDDQTMDEDAFERKS---------MQGELKERNL-TDKTSTLSTSFGETSPD 186

  Fly   162 --------YPHISSA------------PVE---------VPPEVDQSA---ELAGHLGGIAPQVD 194
                    :|.::.:            |::         :|.:.|.|.   :.:.:|......|:
pombe   187 VNPFYLSEWPTVTDSILLSKSLSSDAIPLKNGEIKSTMLMPSDSDNSVPGIQNSNNLENTGAFVE 251

  Fly   195 QA--PQ---------HHAPMDLA------NDTDDLASVSYSIPVPGVGDIAIDVPMAE 235
            .|  ||         |.:|:.|:      ||..:....|.|.|:|....|..:.|..|
pombe   252 NANSPQSNTPLSTFRHSSPLSLSPVITSDNDVANSLFFSNSTPLPSSLKIKKEAPKLE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 24/66 (36%)
Chromo_shadow 89..134 CDD:279701 11/55 (20%)
chp1NP_593666.1 CHROMO 21..>64 CDD:214605 21/41 (51%)
RRM 224..>371 CDD:223796 20/86 (23%)
RRM_SF 313..373 CDD:240668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3374
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R201
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.