DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and chp2

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_596808.1 Gene:chp2 / 2540047 PomBaseID:SPBC16C6.10 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:153 Identity:45/153 - (29%)
Similarity:66/153 - (43%) Gaps:25/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NEPNFVVERIMDKRITSEGK-VEYYIKWRGYTS-ADNTWEPEENC-DCPNLIQKFEESRAKSKKR 65
            ::..|.||.|:|.|:..:|. .:||:||.||.. :||||..||:| .|..||..:.||      |
pombe   172 SDEEFAVEMILDSRMKKDGSGFQYYLKWEGYDDPSDNTWNDEEDCAGCLELIDAYWES------R 230

  Fly    66 GEKKPKCEEIQKLRGYERGLELAEIV---GATDVTGDIKYLVR---------WQFCDEFDLVPSA 118
            |.|......|:..|...|....|..|   .:::....|.|..|         ..:.|. ||..|:
pombe   231 GGKPDLSSLIRLTRSRARSSNEASYVEKDESSNSDDSISYKRRRSRNAANRITDYVDS-DLSESS 294

  Fly   119 QIVEKDPQMLIDYFQKMAPYSRH 141
            .   |:.|..|:.:.|....|::
pombe   295 M---KEKQSKIEKYMKSDKSSKN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 22/51 (43%)
Chromo_shadow 89..134 CDD:279701 11/56 (20%)
chp2NP_596808.1 CHROMO 174..228 CDD:237991 23/53 (43%)
ChSh 316..380 CDD:197638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto101523
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.