DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and CDY1B

DIOPT Version :10

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001003895.1 Gene:CDY1B / 253175 HGNCID:23920 Length:554 Species:Homo sapiens


Alignment Length:59 Identity:21/59 - (35%)
Similarity:35/59 - (59%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEEN-CDCPNLIQKFEESRAKSKKR 65
            |.||.|:|||....|..:|.::|:||...|:|||||:: .:|...:..|...:.:.:|:
Human     6 FEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEKQKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 19/47 (40%)
CSD 85..135 CDD:349275
CDY1BNP_001003895.1 CD_CDY 5..56 CDD:349284 20/49 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..106
crotonase-like 286..482 CDD:119339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.