DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and CBX5

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001120793.1 Gene:CBX5 / 23468 HGNCID:1555 Length:191 Species:Homo sapiens


Alignment Length:157 Identity:56/157 - (35%)
Similarity:94/157 - (59%) Gaps:26/157 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAKSKKRGE 67
            ::|..:|||:::|:|:. :|:|||.:||:|::...||||||:|.|||.||.:|.:...|.|:...
Human    15 EDEEEYVVEKVLDRRVV-KGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGEN 78

  Fly    68 KKPK---------------CEEIQK----------LRGYERGLELAEIVGATDVTGDIKYLVRWQ 107
            .||:               .::|:.          .||:|||||..:|:||||..||:.:|::|:
Human    79 NKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWK 143

  Fly   108 FCDEFDLVPSAQIVEKDPQMLIDYFQK 134
            ..||.|||.:.:...|.||::|.::::
Human   144 DTDEADLVLAKEANVKCPQIVIAFYEE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 25/48 (52%)
Chromo_shadow 89..134 CDD:279701 18/44 (41%)
CBX5NP_001120793.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 25/49 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 6/46 (13%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 24/55 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.