DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and CBX6

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_055107.3 Gene:CBX6 / 23466 HGNCID:1556 Length:412 Species:Homo sapiens


Alignment Length:116 Identity:36/116 - (31%)
Similarity:53/116 - (45%) Gaps:28/116 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAK-----SKKRGE 67
            |..|.|:.:|| .:|::||.:||:|:....:|||||||.....||..||:...:     .|||| 
Human    11 FAAESIIKRRI-RKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRG- 73

  Fly    68 KKPKCEEIQKLRGYERGLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSA 118
            .||| ..:.|.|.....|.::::                    .|.:.|||
Human    74 PKPK-TFLLKARAQAEALRISDV--------------------HFSVKPSA 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 21/48 (44%)
Chromo_shadow 89..134 CDD:279701 4/30 (13%)
CBX6NP_055107.3 CHROMO 10..62 CDD:214605 22/51 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..152
DNA_pol3_gamma3 <237..>331 CDD:331207
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..364
CBX7_C 357..388 CDD:319236
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.