powered by:
Protein Alignment HP1c and CDY2B
DIOPT Version :9
Sequence 1: | NP_651093.1 |
Gene: | HP1c / 42696 |
FlyBaseID: | FBgn0039019 |
Length: | 237 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001001722.1 |
Gene: | CDY2B / 203611 |
HGNCID: | 23921 |
Length: | 541 |
Species: | Homo sapiens |
Alignment Length: | 59 |
Identity: | 21/59 - (35%) |
Similarity: | 35/59 - (59%) |
Gaps: | 1/59 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEEN-CDCPNLIQKFEESRAKSKKR 65
|.||.|:|||....|..:|.::|:||...|:|||||:: .:|...:..|...:.:.:|:
Human 6 FEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEKQKK 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R201 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.