DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and CDY2B

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001001722.1 Gene:CDY2B / 203611 HGNCID:23921 Length:541 Species:Homo sapiens


Alignment Length:59 Identity:21/59 - (35%)
Similarity:35/59 - (59%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEEN-CDCPNLIQKFEESRAKSKKR 65
            |.||.|:|||....|..:|.::|:||...|:|||||:: .:|...:..|...:.:.:|:
Human     6 FEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEKQKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 19/49 (39%)
Chromo_shadow 89..134 CDD:279701
CDY2BNP_001001722.1 CHROMO 5..58 CDD:214605 20/51 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..104
crotonase-like 287..483 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R201
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.