Sequence 1: | NP_651093.1 | Gene: | HP1c / 42696 | FlyBaseID: | FBgn0039019 | Length: | 237 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506569.1 | Gene: | set-31 / 179939 | WormBaseID: | WBGene00007615 | Length: | 503 | Species: | Caenorhabditis elegans |
Alignment Length: | 294 | Identity: | 57/294 - (19%) |
---|---|---|---|
Similarity: | 99/294 - (33%) | Gaps: | 104/294 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 FVVERIMDKRITSEGK-VEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAKSKKRGEKKPK 71
Fly 72 CEEIQKLRGYERGLELA--------------EIVGATDVTG-DIKYLVR---------WQFCDEF 112
Fly 113 D--------LVPSAQIVEKDPQMLIDYFQKMAPYSRHI--------------------------A 143
Fly 144 MRMKGVPEELRLAASRTSYPH------ISSAPVEVPPEVDQSAELAGHLGGIAPQVDQAPQHHAP 202
Fly 203 MDLANDTDDLASVS------YSIPV-----PGVG 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HP1c | NP_651093.1 | Chromo | 9..58 | CDD:278797 | 14/49 (29%) |
Chromo_shadow | 89..134 | CDD:279701 | 12/62 (19%) | ||
set-31 | NP_506569.1 | CHROMO | 44..90 | CDD:214605 | 14/47 (30%) |
SET | 299..425 | CDD:214614 | 5/12 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160161954 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |