DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cec-5

DIOPT Version :10

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001370694.1 Gene:cec-5 / 177537 WormBaseID:WBGene00017993 Length:374 Species:Caenorhabditis elegans


Alignment Length:80 Identity:24/80 - (30%)
Similarity:42/80 - (52%) Gaps:14/80 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EPNFVVERIMDKRIT-SEGKVEYYIKWRGY---TSADNTWEPEENCDCPNLIQKFEES------- 58
            :.:|.||:|:..|.: .:.|..:.:.||||   .|....|| .|..:|.:|::.:::|       
 Worm   112 DEDFAVEKIIAHRFSGKKNKPLFLVMWRGYPNPVSHSEMWE-NELSNCKDLLEAYKDSHDMKPPP 175

  Fly    59 -RAKSKKRGEKK-PK 71
             :..:||:|.|| ||
 Worm   176 VKKSNKKKGSKKSPK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 16/50 (32%)
CSD 85..135 CDD:349275
cec-5NP_001370694.1 CD_CSD 115..167 CDD:475127 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.