DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cec-4

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_501231.1 Gene:cec-4 / 177536 WormBaseID:WBGene00017990 Length:270 Species:Caenorhabditis elegans


Alignment Length:203 Identity:38/203 - (18%)
Similarity:86/203 - (42%) Gaps:44/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNEPNFVVERIMDKRITSEGKVEYYIK---WRGYTSADNTWEPEENCDCPNLIQKFEESRAKSKK 64
            ||..:|  ::|:..::..|..|||.::   .:..|:.:..::.::     :|:..:::   |..|
 Worm    24 KNHDDF--KKIIGHKVVEEHYVEYEVELTSGKTITATEFDFKGDD-----SLLSTYKK---KVTK 78

  Fly    65 RGEKKPKCEEIQKLRGYERGLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLI 129
            :.:.......::::..:.:            |.|...|||:|:....  .|.::::.|:|.....
 Worm    79 QSDDSSGEYAVERVLAHRK------------VKGSPLYLVQWKGYPH--PVWNSEMWEEDLDNCK 129

  Fly   130 DYFQKMAPYSRHIAMRMKGVPEELRLAASRTSYPHISSAPVEVPPEVDQSA----ELAGHLGGIA 190
            |.   :|.|.:|        .|:|::|.:....|  |..|.:.|..:.:.|    :.....|.||
 Worm   130 DL---LAAYKKH--------QEDLKIAQTPKKTP--SKTPKKTPKSLKRRALTPSDDEEEAGPIA 181

  Fly   191 PQVDQAPQ 198
            |:..:.|:
 Worm   182 PEPKKTPK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 7/51 (14%)
Chromo_shadow 89..134 CDD:279701 10/44 (23%)
cec-4NP_501231.1 CHROMO 86..140 CDD:214605 13/78 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.