DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cec-3

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_495652.1 Gene:cec-3 / 174265 WormBaseID:WBGene00011636 Length:339 Species:Caenorhabditis elegans


Alignment Length:85 Identity:23/85 - (27%)
Similarity:42/85 - (49%) Gaps:19/85 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEEN---C---------------DCP 49
            |::..|.||:|:..::| :..:...::|.||.:.::||||||:   |               |..
 Worm    19 KSDEIFEVEKILAHKVT-DNLLVLQVRWLGYGADEDTWEPEEDLQECASEVVAEYYKKLKVTDKT 82

  Fly    50 NLIQKFEESRAKSKKRGEKK 69
            .||:..::...|:|.:..||
 Worm    83 ELIELLQKQIKKNKSQKSKK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 17/66 (26%)
Chromo_shadow 89..134 CDD:279701
cec-3NP_495652.1 Chromo 25..75 CDD:278797 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.