DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and Cdyl

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:196 Identity:53/196 - (27%)
Similarity:77/196 - (39%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEEN-CDCPNLIQKFEESRAKSKKRG------E 67
            ||.|:|||...:||.||.::|:||.|.|:|||||:: .:|...|..|.....:.:|.|      .
Mouse    58 VESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKEGSLARASR 122

  Fly    68 KKPKCEEIQKLRGYERGL----ELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSAQIV-EKDPQM 127
            ..|.....|..|.....|    ..|.:||....:...:.|...|   :|...|:..:. .|:..:
Mouse   123 ASPSNARKQISRSTHSTLSKTNSKALVVGKDHESKSSQLLAASQ---KFRKNPAPSLANRKNMDL 184

  Fly   128 LIDYFQKMAPYSRHIAMRMKGVPEELRLAASRTSYPHISSAPVEVPPEVDQSAELAGHLGGIAPQ 192
            .....:.:.|.|     .:||          |||.........|....|||.||     ..:||:
Mouse   185 AKSGIKILVPKS-----PVKG----------RTSVDGFQGESPEKLDPVDQGAE-----DTVAPE 229

  Fly   193 V 193
            |
Mouse   230 V 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 23/48 (48%)
Chromo_shadow 89..134 CDD:279701 7/45 (16%)
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CHROMO 55..109 CDD:214605 23/50 (46%)
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304 53/196 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158 9/47 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223 8/32 (25%)
crotonase-like 339..535 CDD:119339
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R201
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.