DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and Cbx1

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001349489.1 Gene:Cbx1 / 12412 MGIID:105369 Length:185 Species:Mus musculus


Alignment Length:152 Identity:62/152 - (40%)
Similarity:100/152 - (65%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESR-------- 59
            :.|..:|||:::|:|:. :|||||.:||:|::..|||||||||.|||:||.:|.:|:        
Mouse    16 EEEEEYVVEKVLDRRVV-KGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDK 79

  Fly    60 ---------AKSKKRGEK---KPKCEEIQKLRGYERGLELAEIVGATDVTGDIKYLVRWQFCDEF 112
                     :.|:.:||:   |.|.||.:|.||:.||||...|:||||.:|::.:|::|:..||.
Mouse    80 SEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEA 144

  Fly   113 DLVPSAQIVEKDPQMLIDYFQK 134
            ||||:.:...|.||::|.::::
Mouse   145 DLVPAKEANVKCPQVVISFYEE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 28/48 (58%)
Chromo_shadow 89..134 CDD:279701 18/44 (41%)
Cbx1NP_001349489.1 CD_HP1beta_Cbx1 20..69 CDD:349297 28/49 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 19/60 (32%)
CSD_HP1beta_Cbx1 112..169 CDD:349301 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.