powered by:
Protein Alignment HP1c and cbx2
DIOPT Version :9
Sequence 1: | NP_651093.1 |
Gene: | HP1c / 42696 |
FlyBaseID: | FBgn0039019 |
Length: | 237 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002942815.2 |
Gene: | cbx2 / 100491304 |
XenbaseID: | XB-GENE-970247 |
Length: | 477 |
Species: | Xenopus tropicalis |
Alignment Length: | 71 |
Identity: | 31/71 - (43%) |
Similarity: | 44/71 - (61%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 EPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKF----EESRAKSKKR 65
|..|..|.|:.||: .:|..||.:||||::|..|:||||||...|.|:..| :|...::|||
Frog 9 EQVFAAECILSKRL-RKGTAEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKREQEKELRNKKR 72
Fly 66 GEKKPK 71
| |:|:
Frog 73 G-KRPR 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.