DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6985 and RAD54L

DIOPT Version :10

Sequence 1:NP_651091.1 Gene:CG6985 / 42694 FlyBaseID:FBgn0039017 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_003570.2 Gene:RAD54L / 8438 HGNCID:9826 Length:747 Species:Homo sapiens


Alignment Length:163 Identity:33/163 - (20%)
Similarity:57/163 - (34%) Gaps:32/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PNAKIAICPFNSSHHVNEQEMKVHTTTCPDRGQIQSF------MYPIGCPANPLMDSTLVPSDQG 100
            |..::.:.| .:..||  |...|.:.....||.:...      ..|:.....|:: |...|....
Human   186 PQVQLHVQP-QAKPHV--QPQPVSSANTQPRGPLSQAPTPAPKFAPVAPKFTPVV-SKFSPGAPS 246

  Fly   101 VTGGLMDNTLVPSD--QSVAAGLIDSTMVPSGTGIPDEAEHCSTSLCEE---------ENWDDMN 154
            ..|...:..:||.|  .||:.|   |...||.|    .|:.....|.:|         :|.:.:.
Human   247 GPGPQPNQKMVPPDAPSSVSTG---SPQPPSFT----YAQQKEKPLVQEKQHPQPPPAQNQNQVR 304

  Fly   155 KP----PYNPQEYCKRNLIIRKATQKTKFQRRQ 183
            .|    |...:|..:...:.::..|..:..:||
Human   305 SPGGPGPLTLKEVEELEQLTQQLMQDMEHPQRQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6985NP_651091.1 DUF2439 60..128 CDD:463065 16/75 (21%)
RAD54LNP_003570.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
Required for chromatin remodeling, strand pairing activities and coupling of ATPase activity. /evidence=ECO:0000250 2..9
HepA <97..647 CDD:440319 33/163 (20%)
DEXHc_RAD54A 153..395 CDD:350825 33/163 (20%)
DEGH box 296..299 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.