DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6985 and okr

DIOPT Version :9

Sequence 1:NP_651091.1 Gene:CG6985 / 42694 FlyBaseID:FBgn0039017 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_476661.1 Gene:okr / 33507 FlyBaseID:FBgn0002989 Length:784 Species:Drosophila melanogaster


Alignment Length:447 Identity:84/447 - (18%)
Similarity:142/447 - (31%) Gaps:173/447 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GKVVDTMTYFKQRQLQENDQLEVGSKDVEIQEEIKTVEECLIQRQLEIANWCQKIDAQNGCTDTS 159
            |:..|:....:||.:::.            ||.|..|::|:|:|                     
  Fly   365 GQNTDSTEQERQRAIEKT------------QELIGLVDQCIIRR--------------------- 396

  Fly   160 PPPADSAPVRSHLLKKIKREADAFAPPHLEISQHREDKHVSYAAADSSTSMGKKIYEQNTLKIEN 224
                     .:.:|.|       :.|...|:           ......|::..::| .|.||.:.
  Fly   397 ---------TNQILTK-------YLPVKFEM-----------VICAKLTAIQLELY-TNFLKSDQ 433

  Fly   225 PTKEFTQSEYLCLLTPAELQKKILLFVSEYAQTSKTESSTLKEIFQIVCDHPVLL--KTLGTNPV 287
            ..:..           |:..:|..|       |:..:.:|||:|    |.||.|:  |.......
  Fly   434 VRRSL-----------ADCNEKASL-------TALADITTLKKI----CSHPDLIYEKLTAREKG 476

  Fly   288 FKEIMEVLDAILPPW---PSMGLYDSAKFEFLHVMLDHLVAERGEKCCILANSEDCLTLVRGYCQ 349
            |:....||.:...|.   |.:    |.||..|..||..:.||..:|..:::|....|.|.....:
  Fly   477 FENSQNVLPSNYKPKDLNPEL----SGKFMLLDFMLAAIRAEGNDKVVLISNYTQTLDLFEQLAR 537

  Fly   350 SYSLDHAQLDGPQK-------VNLFNSLADGEPMIGLILTSDLS---ALRALRCKHLIIY----N 400
            .......:|||...       |:.||   |.|....|.:.|..:   .|..:....|.::    |
  Fly   538 KRKYGFVRLDGTMSIKKRSKVVDRFN---DPESDSFLFMLSSKAGGCGLNLIGANRLFMFDPDWN 599

  Fly   401 HNSRQQA---------------NQLLAVGAMDTKIY-----------TLITAGGSPEELQFYGHM 439
            ..:.:||               .:|:|.|:::.||.           |:|....|.|:     |.
  Fly   600 PANDEQAMARVWRDGQKKPCYIYRLVASGSIEEKILQRQTHKKSLSSTIIDNNESAEK-----HF 659

  Fly   440 GDDSIEDLQNCRSQLIPTASNNLADWTKSEPPFDRVFFEETAISDSLD------CIQ 490
            ..|.::||                           ..|:...:||:.|      |:|
  Fly   660 TRDDLKDL---------------------------FTFDANILSDTHDKLKCKRCVQ 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6985NP_651091.1 DUF2439 60..128 CDD:287368 6/32 (19%)
okrNP_476661.1 SNF2_N 159..466 CDD:278600 31/183 (17%)
DEXDc 179..328 CDD:238005
HELICc 493..622 CDD:238034 28/135 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0390
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.