DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcr-1 and RTL2

DIOPT Version :9

Sequence 1:NP_524453.1 Gene:Dcr-1 / 42693 FlyBaseID:FBgn0039016 Length:2249 Species:Drosophila melanogaster
Sequence 2:NP_566661.1 Gene:RTL2 / 821587 AraportID:AT3G20420 Length:391 Species:Arabidopsis thaliana


Alignment Length:314 Identity:88/314 - (28%)
Similarity:145/314 - (46%) Gaps:46/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1947 EQRIPGSTKPNAENVVTVYGAWPTPRSPLLH-----FAPNA-----TEELDQLLSGFEEFEESLG 2001
            |...|..|:.:..|.:......|.|.|..:|     .:|:|     :.|::.:    |..|:.|.
plant     8 EYNFPAITRCSLSNSLPHRPPSPLPSSADIHRFYNSLSPSAPSVPVSSEMESM----EAVEKILN 68

  Fly  2002 YKFRDRSYLLQAMTHASYT--PNRLTDCYQRLEFLGDAVLDYLITRHLYEDPRQHSPGALTDLRS 2064
            |||.::|.|.:|:||.|.|  |:     |:||||:||:.:...|:.:||.......|..|:.||:
plant    69 YKFSNKSLLKEAITHTSCTDFPS-----YERLEFIGDSAIGLAISNYLYLTYPSLEPHDLSLLRA 128

  Fly  2065 ALVNNTIFASLAVRHGFHKFFRHLSPGLNDVIDRFVRIQQENGHCISEEYYLLSEEECDDAED-- 2127
            |.|:....|.:::.||.:.|.|..:|.|::.:..|       ...:.:|         ||...  
plant   129 ANVSTEKLARVSLNHGLYSFLRRNAPSLDEKVKEF-------SEAVGKE---------DDLSVSY 177

  Fly  2128 ---VEVPKALGDVFESIAGAIFLDSNMSLDVVWHVYSNMMSPEIEQFSNSVPKSPIRELLELEPE 2189
               |:.||.|.|:|||:|||:::|.|..|..:|.::..::.|.:..........|:..|.:|..:
plant   178 GGLVKAPKVLADLFESLAGAVYVDVNFDLQRLWVIFRGLLEPIVTLDDLQKQPQPVSMLFKLCHK 242

  Fly  2190 TAKFGKPEKLADGRRVRVTVDVFCKGTFRGIGR--NYRIAKCTAAKCALRQLKK 2241
            ..|....:...|| .|.:.| ::........||  |..||:..|||.|||:|.:
plant   243 HKKRIDIKNWKDG-NVSIAV-IYLDDELLASGRAENKDIARLIAAKEALRKLSE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcr-1NP_524453.1 DEAD-like_helicase_N 15..208 CDD:421690
Dicer_PBD 240..344 CDD:277191
DEAD-like_helicase_C 490..614 CDD:365791
Dicer_dimer 825..916 CDD:397444
PAZ_dicer_like 1091..1212 CDD:239209
RIBOc 1724..1930 CDD:238333
RIBOc 2008..2172 CDD:238333 51/170 (30%)
DSRM_DICER 2177..2240 CDD:380680 19/64 (30%)
RTL2NP_566661.1 Rnc 54..294 CDD:223644 78/266 (29%)
RIBOc 75..226 CDD:238333 51/171 (30%)
dsrm 232..292 CDD:278464 19/61 (31%)
DSRM 313..385 CDD:238007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002051
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.