DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcr-1 and Mrpl44

DIOPT Version :9

Sequence 1:NP_524453.1 Gene:Dcr-1 / 42693 FlyBaseID:FBgn0039016 Length:2249 Species:Drosophila melanogaster
Sequence 2:NP_001074679.1 Gene:Mrpl44 / 69163 MGIID:1916413 Length:333 Species:Mus musculus


Alignment Length:327 Identity:71/327 - (21%)
Similarity:117/327 - (35%) Gaps:93/327 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1971 PRSPLLHFAPNATEELDQLLSGFE---EFEESLGYKFRDRSYLLQA---MTHASYTPNRLTDCYQ 2029
            ||..|....|.....:..:..||.   .|::.|     :|..||:.   ....|..||  .|.:.
Mouse    13 PRRLLAPAVPTLAPPVRGVKKGFRAAFRFQKEL-----ERWRLLRCPPPPVRRSEKPN--WDYHA 70

  Fly  2030 RLEFLGDAV-----LDYLITRHL------YEDPRQHSPG-----ALTDLRSALVNNTIF-ASLAV 2077
            .::..|..:     ||.|.|..:      .|:.::.|.|     ||.:|:.   |..:| ..|:.
Mouse    71 EVQAFGSRLQETFSLDLLKTAFINSCYIKSEEAKRQSLGIEKEAALLNLKD---NQELFEQGLSF 132

  Fly  2078 RHGFHKFFRHLSPGLNDVIDRFVRIQQENGHCISEEYYLLSE------------EECDDAEDVEV 2130
            .|      |.|:..|.   |.|..:..|....:..  :|..|            |:...:.:..|
Mouse   133 SH------RCLTQFLE---DEFPDLPAEGTESLVS--FLTGEAVVCHVARNLAVEQLTLSAEFPV 186

  Fly  2131 P-KALGDVFESIAGAI---------------FLDSNMS---LDVVWHVYSNM--MSPEIEQFSNS 2174
            | ..|...|.::.||:               ||.:.|:   |..:|.|.:.|  :..|:::.:.|
Mouse   187 PLPVLRQTFFAVIGALLQSSGPERAALFIRDFLITQMTGKELFEMWTVVNPMGLLVEELKKRNIS 251

  Fly  2175 VPKSPIRELLELEPETAKFGKPEKLADGRRVRVTVDVFC--KGTFRGIGRNYRIAKCTAAKCALR 2237
            .|:|.:         |.:.|....|.     ...|.::|  |....|.|....:|:..||:.|||
Mouse   252 APESRL---------TRQSGSTTALP-----LYFVGLYCDRKLIAEGPGETVLVAEEEAARVALR 302

  Fly  2238 QL 2239
            :|
Mouse   303 KL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcr-1NP_524453.1 DEAD-like_helicase_N 15..208 CDD:421690
Dicer_PBD 240..344 CDD:277191
DEAD-like_helicase_C 490..614 CDD:365791
Dicer_dimer 825..916 CDD:397444
PAZ_dicer_like 1091..1212 CDD:239209
RIBOc 1724..1930 CDD:238333
RIBOc 2008..2172 CDD:238333 44/216 (20%)
DSRM_DICER 2177..2240 CDD:380680 16/65 (25%)
Mrpl44NP_001074679.1 Rnc 77..305 CDD:223644 55/256 (21%)
DSRM 236..304 CDD:294045 19/81 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..333
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.