| Sequence 1: | NP_524453.1 | Gene: | Dcr-1 / 42693 | FlyBaseID: | FBgn0039016 | Length: | 2249 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001025431.2 | Gene: | mrpl44 / 571210 | ZFINID: | ZDB-GENE-050913-59 | Length: | 332 | Species: | Danio rerio |
| Alignment Length: | 249 | Identity: | 55/249 - (22%) |
|---|---|---|---|
| Similarity: | 83/249 - (33%) | Gaps: | 83/249 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1760 LYITYENVHEG-KLSHLRSKQVANLNLYRLGRRKRLGEYMIATKFEPHDNWLPPCYYVPKELEKA 1823
Fly 1824 LIEAKIPTHHWKLAD--LLDIKNLSSVQIC----EMVREKADALGLEQNGG----AQNGQLDDS- 1877
Fly 1878 --------NDSC-NDFS--------------------CFIPYNLV-------SQHSIPDKSIADC 1906
Fly 1907 VEALIGAYLIECGP-RGAL--------------LFMAW-----LGVRVLPITRQ 1940 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dcr-1 | NP_524453.1 | DEAD-like_helicase_N | 15..208 | CDD:421690 | |
| Dicer_PBD | 240..344 | CDD:277191 | |||
| DEAD-like_helicase_C | 490..614 | CDD:365791 | |||
| Dicer_dimer | 825..916 | CDD:397444 | |||
| PAZ_dicer_like | 1091..1212 | CDD:239209 | |||
| RIBOc | 1724..1930 | CDD:238333 | 51/237 (22%) | ||
| RIBOc | 2008..2172 | CDD:238333 | |||
| DSRM_DICER | 2177..2240 | CDD:380680 | |||
| mrpl44 | NP_001025431.2 | Rnc | <143..303 | CDD:223644 | 21/104 (20%) |
| DSRM | 234..302 | CDD:294045 | 4/13 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0571 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||