powered by:
Protein Alignment Dcr-1 and SPBC11C11.11c
DIOPT Version :9
Sequence 1: | NP_524453.1 |
Gene: | Dcr-1 / 42693 |
FlyBaseID: | FBgn0039016 |
Length: | 2249 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001342751.1 |
Gene: | SPBC11C11.11c / 2539613 |
PomBaseID: | SPBC11C11.11c |
Length: | 606 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 60 |
Identity: | 18/60 - (30%) |
Similarity: | 28/60 - (46%) |
Gaps: | 4/60 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 545 ELEHRRQEEVLKRFRMHDCNVLIGTSVLEEGIDVPK--CNLVVRWDPPTTYRSYVQCKGR 602
|.....:|.:::.||.....||:...||.||.|:|. |.::.| |.::.....|..||
pombe 298 ETNDSERETLIQDFRKKKFPVLVNCMVLTEGTDIPNIDCLMIAR--PTSSPNLLTQMIGR 355
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R301 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.