DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcr-1 and SPBC11C11.11c

DIOPT Version :9

Sequence 1:NP_524453.1 Gene:Dcr-1 / 42693 FlyBaseID:FBgn0039016 Length:2249 Species:Drosophila melanogaster
Sequence 2:NP_001342751.1 Gene:SPBC11C11.11c / 2539613 PomBaseID:SPBC11C11.11c Length:606 Species:Schizosaccharomyces pombe


Alignment Length:60 Identity:18/60 - (30%)
Similarity:28/60 - (46%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 ELEHRRQEEVLKRFRMHDCNVLIGTSVLEEGIDVPK--CNLVVRWDPPTTYRSYVQCKGR 602
            |.....:|.:::.||.....||:...||.||.|:|.  |.::.|  |.::.....|..||
pombe   298 ETNDSERETLIQDFRKKKFPVLVNCMVLTEGTDIPNIDCLMIAR--PTSSPNLLTQMIGR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcr-1NP_524453.1 DEAD-like_helicase_N 15..208 CDD:421690
Dicer_PBD 240..344 CDD:277191
DEAD-like_helicase_C 490..614 CDD:365791 18/60 (30%)
Dicer_dimer 825..916 CDD:397444
PAZ_dicer_like 1091..1212 CDD:239209
RIBOc 1724..1930 CDD:238333
RIBOc 2008..2172 CDD:238333
DSRM_DICER 2177..2240 CDD:380680
SPBC11C11.11cNP_001342751.1 SSL2 3..381 CDD:223989 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R301
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.