DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcr-1 and DDX58

DIOPT Version :9

Sequence 1:NP_524453.1 Gene:Dcr-1 / 42693 FlyBaseID:FBgn0039016 Length:2249 Species:Drosophila melanogaster
Sequence 2:NP_055129.2 Gene:DDX58 / 23586 HGNCID:19102 Length:925 Species:Homo sapiens


Alignment Length:624 Identity:122/624 - (19%)
Similarity:233/624 - (37%) Gaps:149/624 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DNNLHTTVFTPRDFQVELLATAYE-RNTIICLGHRSSKEFIALKLLQELSRR--ARRHGRVSVYL 68
            |.||::. |.||::|:||...|.: :|||||......|.|::|.:.:...::  ..:.|:| |:.
Human   234 DTNLYSP-FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKV-VFF 296

  Fly    69 SCEVGTSTEPCSIYTMLTHLTDLRVW--QEQPDMQIPFDHCWTDYHVSILRPEGFLYLLETREL- 130
            :.::....:..|:::........||.  .......:|.:....:..:.||.|:..:..|:...: 
Human   297 ANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIP 361

  Fly   131 LLSSVELIVLEDCHDSAVYQRIRPLFENHI---MPAPPADRPRILGL-----AGPLHSAGCELQQ 187
            .||...|::.::||:::.......:..|::   :.......|:::||     .|...:....|..
Human   362 SLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDY 426

  Fly   188 LSAMLATLEQSVLCQIETASDIVTVLRYCSRPHEYIVQCAPFEMDELSLVLADVLNTHKSFLLDH 252
            :..:.|:|:.||:..::...:.:..:.|  :|.::..:......|:...::|.::...:|  |..
Human   427 ICKLCASLDASVIATVKHNLEELEQVVY--KPQKFFRKVESRISDKFKYIIAQLMRDTES--LAK 487

  Fly   253 RYDPYEIYGTDQFMDELKDIPDPKVDPLNVINSLLVVLHEMGPW-CTQRAAHHFYQCNEK----- 311
            |.              .||:     :.|:.|.:......:...| .|.:.|...:|..:|     
Human   488 RI--------------CKDL-----ENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESR 533

  Fly   312 ----LKVKTPHERHYLLYCLVSTALIQLYSLCEHAFHRHLGSGSDSRQTIERYSSPKVRRLLQTL 372
                |.:.|.|.|.|      :.|||    :.|||                        |:...|
Human   534 ICKALFLYTSHLRKY------NDALI----ISEHA------------------------RMKDAL 564

  Fly   373 RCFKPEEVHTQADGLRRMRHQVDQADFNRLSHTLESKCRMVDQMDQPPTETRALVATLEQILHTT 437
            ...|....:.:|.|.    .:::|    .|:...|.|.:.::.:.:.|:.....:..|..||.  
Human   565 DYLKDFFSNVRAAGF----DEIEQ----DLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQ-- 619

  Fly   438 EDRQTNRSAARVTPTPTPAHAKPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCNQN 502
            |:...|                           |.|...::.:                      
Human   620 EEYHLN---------------------------PETITILFVK---------------------- 635

  Fly   503 HTARVLFELLAEISRRDPDLKFLRCQYTTDRVADPTTEPKEAELEHRRQEEVLKRFRMH-DCNVL 566
              .|.|.:.|......:|.|.||:....|.|  ..|.:.....|.  .|:.:|..|:.. |.|:|
Human   636 --TRALVDALKNWIEGNPKLSFLKPGILTGR--GKTNQNTGMTLP--AQKCILDAFKASGDHNIL 694

  Fly   567 IGTSVLEEGIDVPKCNLVVRWDPPTTYRSYVQCKGRARA 605
            |.|||.:||||:.:||||:.::........:|.:||.||
Human   695 IATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRA 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcr-1NP_524453.1 DEAD-like_helicase_N 15..208 CDD:421690 41/206 (20%)
Dicer_PBD 240..344 CDD:277191 23/113 (20%)
DEAD-like_helicase_C 490..614 CDD:365791 34/117 (29%)
Dicer_dimer 825..916 CDD:397444
PAZ_dicer_like 1091..1212 CDD:239209
RIBOc 1724..1930 CDD:238333
RIBOc 2008..2172 CDD:238333
DSRM_DICER 2177..2240 CDD:380680
DDX58NP_055129.2 DD 2..92 CDD:326335
CARD_RIG-I_r2 100..189 CDD:260076
Interaction with ZC3HAV1. /evidence=ECO:0000269|PubMed:21102435 218..925 122/624 (20%)
helicase_insert_domain 243..771 CDD:327377 118/614 (19%)
DECH box 372..375 0/2 (0%)
Mediates interaction with RNF135. /evidence=ECO:0000269|PubMed:23950712 735..925
RIG-I_C 805..918 CDD:276943
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.