DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and RIPK2

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_003812.1 Gene:RIPK2 / 8767 HGNCID:10020 Length:540 Species:Homo sapiens


Alignment Length:281 Identity:86/281 - (30%)
Similarity:136/281 - (48%) Gaps:33/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPYEEIQTKELIGTGFYGSV---YRAVWRNREIALKRIR-----EGCEDKKIEREIYQLTKASHV 64
            :||.::.....:..|..|:|   ..|.|| .::|:|.:.     ...|.|.:.||...|.||...
Human    13 IPYHKLADLRYLSRGASGTVSSARHADWR-VQVAVKHLHIHTPLLDSERKDVLREAEILHKARFS 76

  Fly    65 NIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSK-PSYSHAHAFNWAHQIAQGIAYLHGMQPK 128
            .|:.:.|.........::.|::..|||:..||.|:: |..:....|...|:||.|:.|||.|.| 
Human    77 YILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTP- 140

  Fly   129 AVIHRDIKPLNTLLCEKGLKLKICDFG----TVVDLSQSISCNA----GTCRYKAPEVL---QGN 182
            .::|.|:|..|.|| :....:||.|||    .::.||||.|..:    ||..|..||..   |.:
Human   141 PLLHHDLKTQNILL-DNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKS 204

  Fly   183 KPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADI------VA 241
            :...|.|:||:|:..||:||||:|||......::..::::|.||.::  ....|.||      ::
Human   205 RASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVIN--EESLPYDIPHRARMIS 267

  Fly   242 LLYASW--DPDISKRFSMELI 260
            |:.:.|  :||....|...||
Human   268 LIESGWAQNPDERPSFLKCLI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 82/271 (30%)
PKc_like 19..268 CDD:304357 84/270 (31%)
RIPK2NP_003812.1 STKc_RIP2 20..303 CDD:270928 84/274 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..369
CARD_RIP2_CARD3 438..524 CDD:176764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4962
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.