DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and MAP3K21

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_115811.2 Gene:MAP3K21 / 84451 HGNCID:29798 Length:1036 Species:Homo sapiens


Alignment Length:311 Identity:99/311 - (31%)
Similarity:154/311 - (49%) Gaps:39/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAPVEGVPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCED------KKIEREIYQLTK 60
            |:||. |.:|.::.|||||.|.:|.||||.|:.:|:|:|..|:..|.      :.:.||......
Human   114 SSPVH-VAFERLELKELIGAGGFGQVYRATWQGQEVAVKAARQDPEQDAAAAAESVRREARLFAM 177

  Fly    61 ASHVNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHA-----------HAF-NWAH 113
            ..|.||:||.|....:....|::||..||:|:..|.|.:......|           |.. |||.
Human   178 LRHPNIIELRGVCLQQPHLCLVLEFARGGALNRALAAANAAPDPRAPGPRRARRIPPHVLVNWAV 242

  Fly   114 QIAQGIAYLHGMQPKAVIHRDIKPLNTLLCEK-------GLKLKICDFGTVVDLSQSISCN-AGT 170
            |||:|:.|||......::|||:|..|.||.||       ...|||.|||...:..::...: |||
Human   243 QIARGMLYLHEEAFVPILHRDLKSSNILLLEKIEHDDICNKTLKITDFGLAREWHRTTKMSTAGT 307

  Fly   171 CRYKAPEVLQGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELY-MAINEGERPDLSCIMSG 234
            ..:.||||::.:...:..|::|:.:..||:|:.:.|:...:.|...| :|:|:...|    |.|.
Human   308 YAWMAPEVIKSSLFSKGSDIWSYGVLLWELLTGEVPYRGIDGLAVAYGVAVNKLTLP----IPST 368

  Fly   235 CPADIVALLYASW--DPDISKRFS--MELISQSMGRILSEAGSIPPLDFYS 281
            ||.....|:...|  ||.|...|:  :|.::...|.:::|   :|...|:|
Human   369 CPEPFAKLMKECWQQDPHIRPSFALILEQLTAIEGAVMTE---MPQESFHS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 88/274 (32%)
PKc_like 19..268 CDD:304357 87/279 (31%)
MAP3K21NP_115811.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
SH3_MLK4 42..97 CDD:212991
PKc_like 129..401 CDD:328722 87/275 (32%)
Leucine-zipper 1 425..446
Leucine-zipper 2 460..481
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..551
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 748..791
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 923..954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.