DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT5G50000

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_199811.1 Gene:AT5G50000 / 835064 AraportID:AT5G50000 Length:385 Species:Arabidopsis thaliana


Alignment Length:296 Identity:87/296 - (29%)
Similarity:142/296 - (47%) Gaps:42/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLT-----------KASHVNIVEL 69
            |.::..|.:|:|:|.::..:::|:|.:..|.|..:.|.||..|.           |..|.|:.:.
plant    85 KTVLARGTFGTVHRGIYDGQDVAVKLLDWGEEGHRSEAEIVSLRADFAQEVAVWHKLDHPNVTKF 149

  Fly    70 YG-TSRHEGCAL---------------LLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQG 118
            .| |....|..|               :::|::.||:|.|:|....:...:.......|..:|:|
plant   150 IGATMGASGLQLQTESGPLAMPNNICCVVVEYLPGGALKSYLIKNRRRKLTFKIVVQLALDLARG 214

  Fly   119 IAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTV-VDLS--QSISCNAGTCRYKAPEVLQ 180
            ::|||..:   ::|||:|..|.|| :|...:||.|||.. |:.|  ..::...||..|.|||||.
plant   215 LSYLHSQK---IVHRDVKTENMLL-DKTRTVKIADFGVARVEASNPNDMTGETGTLGYMAPEVLN 275

  Fly   181 GNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMA-INEGERPDL-SCIMSGCPADIVALL 243
            ||..:.||||||:.|..|||.....|:... |..|:..| :.:..|||: .|    ||:.:.|::
plant   276 GNPYNRKCDVYSFGICLWEIYCCDMPYPDL-TFSEVTSAVVRQNLRPDIPRC----CPSALAAVM 335

  Fly   244 YASWDPDISKRFSMELISQSMGRI-LSEAGSIPPLD 278
            ...||.:..||..|:.:...:..| .::.|.:.|.|
plant   336 KRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPND 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 82/273 (30%)
PKc_like 19..268 CDD:304357 83/281 (30%)
AT5G50000NP_199811.1 STKc_MAP3K-like 88..356 CDD:270901 82/276 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D635654at2759
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.