DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT5G41730

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001330018.1 Gene:AT5G41730 / 834176 AraportID:AT5G41730 Length:711 Species:Arabidopsis thaliana


Alignment Length:283 Identity:82/283 - (28%)
Similarity:116/283 - (40%) Gaps:50/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLTKASHVNIVE----LYGTSRHE 76
            |.|...|.|..:.   |.....||:......|  .:..||..|....|.||::    .|...|.|
plant   244 KRLDADGQYKEIQ---WLGDSFALRHFFSDLE--PLSSEISSLLALCHSNILQYLCGFYDEERKE 303

  Fly    77 GCALLLMEFVDGGSLSSFLHAKSKPS----YSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKP 137
              ..|:||.:. ..|.|::.....|.    :|.....:...|||:|:.||||   ..:.|.|:.|
plant   304 --CFLVMELMH-KDLQSYMKENCGPRRRYLFSIPVVIDIMLQIARGMEYLHG---NDIFHGDLNP 362

  Fly   138 LNTLLCEKG-----LKLKICDFGTVVDLSQSISCNAGT---CRYKAPEV-------LQGNKP--- 184
            :|..|.|:.     ...|||.||....:....|...||   ..:.||||       |.|..|   
plant   363 MNIHLKERSHTEGYFHAKICGFGLSSVVKAQSSSKPGTPDPVIWYAPEVLAEMEQDLNGKTPKSK 427

  Fly   185 -DEKCDVYSWAITFWEILSRKEPFEQYNTLFE-LYMAINEGERPDLSCIMSGCPADIVALLYASW 247
             ..|.||||:|:..:|:::.|.|||..:...| :.:.|..||||   ......|..:|:|:...|
plant   428 LTHKADVYSFAMVCFELITGKVPFEDSHLQGEPMTINIRMGERP---LFPFPSPKYLVSLIKRCW 489

  Fly   248 DPDISKR--FSMELISQSMGRIL 268
            ..:.|:|  ||      |:.|||
plant   490 HSEPSQRPNFS------SICRIL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 78/271 (29%)
PKc_like 19..268 CDD:304357 78/278 (28%)
AT5G41730NP_001330018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23257
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.