DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT5G01850

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001332324.1 Gene:AT5G01850 / 831760 AraportID:AT5G01850 Length:357 Species:Arabidopsis thaliana


Alignment Length:295 Identity:80/295 - (27%)
Similarity:137/295 - (46%) Gaps:56/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGTGFYGSVYRAVWRNREIALKRIREGCE-------DKKIEREIYQLTKASHVNIVEL------- 69
            ||.|.:|.||:..:..:.:|:|.:..|.:       :.:..||:..:::..|.|:|::       
plant    24 IGEGAHGKVYQGRYGRQIVAIKVVNRGSKPDQQSSLESRFVREVNMMSRVQHHNLVKVSLLLSSL 88

  Fly    70 ---------YGTSRHE---GC----ALLLMEFVDGGSLSSFLHAKSKPSYSHAH-AFNWAHQIAQ 117
                     |..|..:   .|    .:::.|.:.|.||..:| ...:|...|.. |.::|..||:
plant    89 SLLSILLLEYTISIWQFIGACKDPLMVIVTELLPGMSLRKYL-TSIRPQLLHLPLALSFALDIAR 152

  Fly   118 GIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVD--LSQSISCNAGTCRYKAPEVL- 179
            .   ||.:....:||||:||.|.||.|....:|:.|||...:  :::.::...||.|:.|||:. 
plant   153 A---LHCLHANGIIHRDLKPDNLLLTENHKSVKLADFGLAREESVTEMMTAETGTYRWMAPELYS 214

  Fly   180 -----QGNKP--DEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPA 237
                 ||.|.  :.|.||||:.|..||:|:.:.|||..:.|...|.|..:.|||   .:..|...
plant   215 TVTLRQGEKKHYNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAAFKQERP---VMPEGISP 276

  Fly   238 DIVALLYASW--DPDISKRFSMELISQSMGRILSE 270
            .:..::.:.|  ||::...||..:      |:|:|
plant   277 SLAFIVQSCWVEDPNMRPSFSQII------RLLNE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 77/281 (27%)
PKc_like 19..268 CDD:304357 78/291 (27%)
AT5G01850NP_001332324.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.