DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT4G31170

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001031758.1 Gene:AT4G31170 / 829245 AraportID:AT4G31170 Length:412 Species:Arabidopsis thaliana


Alignment Length:269 Identity:76/269 - (28%)
Similarity:126/269 - (46%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVEG-VPYEE--IQTKEL-----IGTGFYGSVYRAVWRNREIALKRIREG--------CEDKKIE 52
            |.|| |.|||  |..::|     ...|.:|.:||..:...::|:|.:...        ..:::.:
plant   114 PTEGLVNYEEWTIDLRKLHMGPAFAQGAFGKLYRGTYNGEDVAIKLLERSDSNPEKAQALEQQFQ 178

  Fly    53 REIYQLTKASHVNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQ 117
            :|:..|....|.|||...|.........::.|:..|||:..||..:...:.....|...|..:|:
plant   179 QEVSMLAFLKHPNIVRFIGACIKPMVWCIVTEYAKGGSVRQFLTKRQNRAVPLKLAVMQALDVAR 243

  Fly   118 GIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTV-VDL-SQSISCNAGTCRYKAPEVLQ 180
            |:||:|   .:..||||:|..| ||......:||.|||.. ::: ::.::...||.|:.|||::|
plant   244 GMAYVH---ERNFIHRDLKSDN-LLISADRSIKIADFGVARIEVQTEGMTPETGTYRWMAPEMIQ 304

  Fly   181 GNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALL-- 243
            .....:|.||||:.|..||:::...||:....:...:..:|.|.||.:       |||.:.:|  
plant   305 HRPYTQKVDVYSFGIVLWELITGLLPFQNMTAVQAAFAVVNRGVRPTV-------PADCLPVLGE 362

  Fly   244 --YASWDPD 250
              ...||.|
plant   363 IMTRCWDAD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 68/256 (27%)
PKc_like 19..268 CDD:304357 67/246 (27%)
AT4G31170NP_001031758.1 STKc_MAP3K-like 138..385 CDD:270901 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.