DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT4G14780

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_193214.1 Gene:AT4G14780 / 827133 AraportID:AT4G14780 Length:364 Species:Arabidopsis thaliana


Alignment Length:300 Identity:78/300 - (26%)
Similarity:136/300 - (45%) Gaps:42/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EIQTKELIGTGFYGSVYRAVWRNREIALKRI---REGCEDKK--------IEREIYQLTKASHVN 65
            :::|..:|..|.||:||:.::..:::|:|.:   .:|.|...        ..:|:....|.:|.|
plant    60 KLETSNVIARGTYGTVYKGIYDGQDVAVKVLDWEDDGNETTAKTATNRALFRQEVTVWHKLNHPN 124

  Fly    66 IVELYGTSR-----------------HEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAH 113
            :.:..|.|.                 .:.|. :::|::.||:|...|........:.......|.
plant   125 VTKFVGASMGTTNLNIRSADSKGSLPQQACC-VVVEYLPGGTLKQHLIRHKSKKLAFKAVIKLAL 188

  Fly   114 QIAQGIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGT--VVDLS-QSISCNAGTCRYKA 175
            .:|:|::|||.   :.::|||:|..|.|| :....|||.|||.  |..|: :.::...||..|.|
plant   189 DLARGLSYLHS---EKIVHRDVKTENMLL-DAQKNLKIADFGVARVEALNPKDMTGETGTLGYMA 249

  Fly   176 PEVLQGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDL-SCIMSGCPADI 239
            |||:.|...:.:|||||:.|..|||.....|:...:.:......:....||:: .|    ||..:
plant   250 PEVIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDVSSAVVLHNLRPEIPRC----CPTAL 310

  Fly   240 VALLYASWDPDISKRFSM-ELISQSMGRILSEAGSIPPLD 278
            ..::...||.:..||..| |::....|...|:.|.:.|.|
plant   311 AGIMKTCWDGNPQKRPEMKEVVKMLEGVDTSKGGGMIPED 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 72/276 (26%)
PKc_like 19..268 CDD:304357 73/281 (26%)
AT4G14780NP_193214.1 STYKc 61..335 CDD:214568 73/282 (26%)
STKc_MAP3K-like 67..335 CDD:270901 72/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D635654at2759
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.