DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT3G50730

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_190642.2 Gene:AT3G50730 / 824237 AraportID:AT3G50730 Length:371 Species:Arabidopsis thaliana


Alignment Length:285 Identity:82/285 - (28%)
Similarity:149/285 - (52%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EIQTKELIGTGFYGSVYRAVWRNR-EIALKRIREG-------CEDKKIEREIYQLTKASHVNIVE 68
            ::...|:||.|.|..||:.:.||: .:|:|.:...       ...|..::|:..|:|..|.|||:
plant    35 DVVVGEMIGEGAYSIVYKGLLRNQFPVAVKIMDPSTTSAVTKAHKKTFQKEVLLLSKMKHDNIVK 99

  Fly    69 LYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHR 133
            ..|.. .|...:::.|.|:||:|..|:|::..| .....:.::|..|::.:.::|.   ..:|||
plant   100 FVGAC-IEPQLIIVTELVEGGTLQRFMHSRPGP-LDLKMSLSFALDISRAMEFVHS---NGIIHR 159

  Fly   134 DIKPLNTLLCEKGLKLKICDFGTVVDLSQ-SISCNAGTCRYKAPEVLQGNKP---------DEKC 188
            |:.|.|.|:......:|:.|||...:.:: .::|.|||.::.||||:...:|         |.|.
plant   160 DLNPRNLLVTGDLKHVKLADFGIAREETRGGMTCEAGTSKWMAPEVVYSPEPLRVGEKKEYDHKA 224

  Fly   189 DVYSWAITFWEILSRKEPFEQY-NTLFELYMAINEGERPDLSCIMSGCPADIVALLYASW--DPD 250
            |:||:||..|::::.:|||... |:||..|: :::|.||    |::..|...|.::.:.|  |||
plant   225 DIYSFAIVLWQLVTNEEPFPDVPNSLFVPYL-VSQGRRP----ILTKTPDVFVPIVESCWAQDPD 284

  Fly   251 ISKRF-SMELISQSMGRILSEAGSI 274
            ....| .:.::..::.|.:|...||
plant   285 ARPEFKEISVMLTNLLRRMSSDSSI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 78/265 (29%)
PKc_like 19..268 CDD:304357 78/270 (29%)
AT3G50730NP_190642.2 TyrKc 36..292 CDD:197581 78/265 (29%)
STKc_MAP3K-like 42..296 CDD:270901 77/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D635654at2759
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.