DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT3G50720

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_190641.1 Gene:AT3G50720 / 824236 AraportID:AT3G50720 Length:377 Species:Arabidopsis thaliana


Alignment Length:276 Identity:88/276 - (31%)
Similarity:143/276 - (51%) Gaps:28/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EEIQTKELIGTGFYGSVYRAVWRN-REIALKRIREG------CEDK-KIEREIYQLTKASHVNIV 67
            ::|...|:||.|....||:...:| ..:|:|.::.|      .:|| :.::|:..|:...|.|||
plant    46 KDIMRGEMIGEGGNSIVYKGRLKNIVPVAVKIVQPGKTSAVSIQDKQQFQKEVLVLSSMKHENIV 110

  Fly    68 ELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPS-YSHAHAFNWAHQIAQGIAYLHGMQPKAVI 131
            ...|.. .|...:::.|.|.||:|..|: ..|:|| .....:.::|..|::.:.|||.   |.:|
plant   111 RFVGAC-IEPQLMIVTELVRGGTLQRFM-LNSRPSPLDLKVSLSFALDISRAMEYLHS---KGII 170

  Fly   132 HRDIKPLNTLLCEKGLKLKICDFGTVVDLS-QSISCNAGTCRYKAPEVLQ------GNKP--DEK 187
            |||:.|.|.|:......:|:.|||...:.: ..::|.|||.|:.||||..      |.|.  |:|
plant   171 HRDLNPRNVLVTGDMKHVKLADFGLAREKTLGGMTCEAGTYRWMAPEVCSREPLRIGEKKHYDQK 235

  Fly   188 CDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWDPDIS 252
            .||||:|:.||.:|:.|.||.:..::...|. :|:|:||.||.|    |.::|.:|...|..|..
plant   236 IDVYSFALIFWSLLTNKTPFSEIPSISIPYF-VNQGKRPSLSNI----PDEVVPILECCWAADSK 295

  Fly   253 KRFSMELISQSMGRIL 268
            .|...:.|:.|:..:|
plant   296 TRLEFKDITISLESLL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 84/261 (32%)
PKc_like 19..268 CDD:304357 85/266 (32%)
AT3G50720NP_190641.1 STKc_MAP3K-like 54..304 CDD:270901 83/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D635654at2759
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.