DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and ATN1

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_189393.1 Gene:ATN1 / 822378 AraportID:AT3G27560 Length:356 Species:Arabidopsis thaliana


Alignment Length:278 Identity:84/278 - (30%)
Similarity:134/278 - (48%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGTGFYGSVYRAVWRNREIALKRIREG-------CEDKKIEREIYQLTKASHVNIVELYGTSRHE 76
            ||.|.:..||...:||:.:|:|.|:.|       ..|.:..|||..|:|..|.|:|:..|..: |
plant    32 IGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDNRFAREIAMLSKVQHKNLVKFIGACK-E 95

  Fly    77 GCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKPLNTL 141
            ...:::.|.:.||:|..:|.:..........|..:|..||:.:..||.   ..:||||:||.|.:
plant    96 PMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVGFALDIARAMECLHS---HGIIHRDLKPENLI 157

  Fly   142 LCEKGLKLKICDFGTVVD--LSQSISCNAGTCRYKAPEVL------QGNKP--DEKCDVYSWAIT 196
            |......:|:.|||...:  |::.::...||.|:.|||:.      ||.|.  :.|.|.||:||.
plant   158 LSADHKTVKLADFGLAREESLTEMMTAETGTYRWMAPELYSTVTLRQGEKKHYNHKVDAYSFAIV 222

  Fly   197 FWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWDPDISKRFSMELIS 261
            .||::..|.|||..:.|...|.|..:..||....:    |.|:..::.:.|..|.::|.:...|.
plant   223 LWELILNKLPFEGMSNLQAAYAAAFKNLRPSAEDL----PGDLEMIVTSCWKEDPNERPNFTEII 283

  Fly   262 QSMGRILSEAGS---IPP 276
            |.:.|.|:...:   |||
plant   284 QMLLRYLTTVSAPQIIPP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 77/255 (30%)
PKc_like 19..268 CDD:304357 80/265 (30%)
ATN1NP_189393.1 STKc_MAP3K-like 32..286 CDD:270901 79/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.