DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT3G22750

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_566716.1 Gene:AT3G22750 / 821846 AraportID:AT3G22750 Length:378 Species:Arabidopsis thaliana


Alignment Length:312 Identity:78/312 - (25%)
Similarity:135/312 - (43%) Gaps:52/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PYEE-------IQTKELIGTGFYGSVYRAVWRNREIALKRIREGCED------------KKIERE 54
            |.||       ::.:.:|..|.||.||:.::..:::|:|.:..| ||            ....:|
plant    63 PKEEWEIELAKLEMRNVIARGAYGIVYKGIYDGQDVAVKVLDWG-EDGYATTAETSALRASFRQE 126

  Fly    55 IYQLTKASHVNIVELYGTSR------------------HEGCALLLMEFVDGGSLSSFLHAKSKP 101
            :....|..|.|:....|.|.                  ...|. :::|::.||:|..:|....:.
plant   127 VAVWHKLDHPNVTRFVGASMGTANLKIPSSAETENSLPQRACC-VVVEYIPGGTLKQYLFRNRRK 190

  Fly   102 SYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQS--- 163
            ..:.......|..:::|::|||.   :.::|||:|..|.|| :....|||.|||.....:|:   
plant   191 KLAFKVVVQLALDLSRGLSYLHS---ERIVHRDVKTENMLL-DYQRNLKIADFGVARVEAQNPKD 251

  Fly   164 ISCNAGTCRYKAPEVLQGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDL 228
            ::...||..|.|||||.|...:.:|||||:.|..|||.....|:...:........:.:..|||:
plant   252 MTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVSSAVVRQNLRPDI 316

  Fly   229 -SCIMSGCPADIVALLYASWDPDISKRFSMELISQSMGRI-LSEAGSIPPLD 278
             .|    ||..:..::...|:.:..||..||.:...:..: .::.|.:.|.|
plant   317 PRC----CPTALATIMKRCWEANPEKRPEMEEVVSLLEAVDTTKGGGMIPED 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 70/277 (25%)
PKc_like 19..268 CDD:304357 72/283 (25%)
AT3G22750NP_566716.1 Pkinase_Tyr 74..349 CDD:285015 72/284 (25%)
STKc_MAP3K-like 80..349 CDD:270901 72/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D635654at2759
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.