DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT3G01490

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_186798.1 Gene:AT3G01490 / 821136 AraportID:AT3G01490 Length:411 Species:Arabidopsis thaliana


Alignment Length:300 Identity:84/300 - (28%)
Similarity:133/300 - (44%) Gaps:53/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLT-----------KASHVNIVEL 69
            |.:|..|.:|:|:|.::..:::|:|.:..|.|..:.:.||..|.           |..|.|:.:.
plant   111 KSVIARGTFGTVHRGIYDGQDVAVKLLDWGEEGHRSDAEIASLRAAFTQEVAVWHKLDHPNVTKF 175

  Fly    70 YGTS----------------RHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQG 118
            .|.:                .......:::|:..||:|.|||....:...:.......:..:|:|
plant   176 IGAAMGTSEMSIQTENGQMGMPSNVCCVVVEYCPGGALKSFLIKTRRRKLAFKVVIQLSLDLARG 240

  Fly   119 IAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQS----ISCNAGTCRYKAPEVL 179
            ::|||..:   ::|||:|..|.|| :|...|||.||| |..|..|    ::...||..|.|||||
plant   241 LSYLHSQK---IVHRDVKTENMLL-DKSRTLKIADFG-VARLEASNPNDMTGETGTLGYMAPEVL 300

  Fly   180 QGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDL-SCIMSGCPADIVALL 243
            .|:..:.||||||:.|..|||.....|:...:........:.:..||:: .|    ||:.:..::
plant   301 NGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRC----CPSSLANVM 361

  Fly   244 YASWDPDISKRFSM-------ELISQSMGRILSEAGSIPP 276
            ...||.:..||..|       |.|..|.|     .|.|||
plant   362 KRCWDANPEKRPEMEEVVAMLEAIDTSKG-----GGMIPP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 76/280 (27%)
PKc_like 19..268 CDD:304357 79/287 (28%)
AT3G01490NP_186798.1 STKc_MAP3K-like 114..382 CDD:270901 75/276 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D635654at2759
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.