DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and AT2G24360

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_565568.1 Gene:AT2G24360 / 816972 AraportID:AT2G24360 Length:411 Species:Arabidopsis thaliana


Alignment Length:299 Identity:83/299 - (27%)
Similarity:142/299 - (47%) Gaps:47/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVEGVP-YEE--IQTKEL-----IGTGFYGSVYRAVWRNREIALKRIREGCE---------DKKI 51
            |.||:. |:|  |..::|     ...|.:|.:|:..:...::|:| |.|..|         :::.
plant   113 PTEGLTNYDEWTIDLRKLNMGPAFAQGAFGKLYKGTYNGEDVAIK-ILERPENSPEKAQFMEQQF 176

  Fly    52 EREIYQLTKASHVNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIA 116
            ::|:..|....|.|||...|..|......::.|:..|||:..||..:...:.....|...|..:|
plant   177 QQEVSMLANLKHPNIVRFIGACRKPMVWCIVTEYAKGGSVRQFLTRRQNRAVPLKLAVKQALDVA 241

  Fly   117 QGIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTV-VDL-SQSISCNAGTCRYKAPEVL 179
            :|:||:||   :..||||:|..| ||......:||.|||.. ::: ::.::...||.|:.|||::
plant   242 RGMAYVHG---RNFIHRDLKSDN-LLISADKSIKIADFGVARIEVQTEGMTPETGTYRWMAPEMI 302

  Fly   180 QGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPD--------LSCIMSGCP 236
            |....::|.||||:.|..||:::...||:....:...:..:|.|.||.        ||.||:.| 
plant   303 QHRAYNQKVDVYSFGIVLWELITGLLPFQNMTAVQAAFAVVNRGVRPTVPNDCLPVLSDIMTRC- 366

  Fly   237 ADIVALLYASWD--PDISKRF--SMELISQSMGRILSEA 271
                      ||  |::...|  .::|:..:...|::.|
plant   367 ----------WDANPEVRPCFVEVVKLLEAAETEIMTTA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 74/271 (27%)
PKc_like 19..268 CDD:304357 74/271 (27%)
AT2G24360NP_565568.1 STKc_MAP3K-like 137..384 CDD:270901 73/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.