DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and LRRK1

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_078928.3 Gene:LRRK1 / 79705 HGNCID:18608 Length:2015 Species:Homo sapiens


Alignment Length:287 Identity:77/287 - (26%)
Similarity:129/287 - (44%) Gaps:56/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LIGTGFYGSV-YRAVWRNREIALKRIR----------------------EGCED-KKIEREIYQL 58
            ::|.|..|:| |||.::.:.:|:||..                      :..:: .:..:|...|
Human  1247 VLGQGGSGTVIYRARYQGQPVAVKRFHIKKFKNFANVPADTMLRHLRATDAMKNFSEFRQEASML 1311

  Fly    59 TKASHVNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPS----YSHAHAFNWAHQIAQGI 119
            ....|..||.|.|.|.|..|  ..:|.....||::.|...::.|    ..|......|:|||.|:
Human  1312 HALQHPCIVALIGISIHPLC--FALELAPLSSLNTVLSENARDSSFIPLGHMLTQKIAYQIASGL 1374

  Fly   120 AYLHGMQPKAVIHRDIKPLNTLL----CEKGLKLKICDFGTVVDLSQSISCNA----GTCRYKAP 176
            ||||   .|.:|..|:|..|.|:    .::.:.:|:.|:|.   ..||....|    ||..|:||
Human  1375 AYLH---KKNIIFCDLKSDNILVWSLDVKEHINIKLSDYGI---SRQSFHEGALGVEGTPGYQAP 1433

  Fly   177 EVLQGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADI-- 239
            |:......|||.|::|:.:..:|:||.:.|...::.| ::...:::|.||.|     |.|.::  
Human  1434 EIRPRIVYDEKVDMFSYGMVLYELLSGQRPALGHHQL-QIAKKLSKGIRPVL-----GQPEEVQF 1492

  Fly   240 ---VALLYASWDPDISKR-FSMELISQ 262
               .||:...||....|| .::.::||
Human  1493 RRLQALMMECWDTKPEKRPLALSVVSQ 1519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 75/281 (27%)
PKc_like 19..268 CDD:304357 77/286 (27%)
LRRK1NP_078928.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..56
ANK 1 86..116
ANK 95..214 CDD:238125
ANK 2 119..148
Ank_2 126..221 CDD:289560
ANK 3 152..182
ANK repeat 156..186 CDD:293786
ANK repeat 188..218 CDD:293786
ANK 4 193..222
LRR_RI <214..488 CDD:238064
LRR 1 279..300
leucine-rich repeat 281..303 CDD:275380
LRR 302..614 CDD:227223
LRR 2 303..324
leucine-rich repeat 304..330 CDD:275380
LRR 3 330..351
leucine-rich repeat 331..353 CDD:275380
LRR 4 353..374
leucine-rich repeat 354..381 CDD:275380
LRR_RI 379..641 CDD:238064
LRR 5 381..402
leucine-rich repeat 382..405 CDD:275380
LRR 6 405..426
leucine-rich repeat 406..451 CDD:275380
LRR 7 427..447
LRR 8 451..472
leucine-rich repeat 452..474 CDD:275380
LRR 9 474..495
leucine-rich repeat 475..498 CDD:275380
LRR 10 498..519
leucine-rich repeat 499..549 CDD:275380
LRR 11 549..570
leucine-rich repeat 550..572 CDD:275380
LRR 12 572..594
LRR 13 596..617
Gem1 635..>781 CDD:224025
P-loop_NTPase 639..821 CDD:304359
COR 844..1036 CDD:292713
S_TKc 1245..1511 CDD:214567 74/277 (27%)
STKc_LRRK1 1248..1523 CDD:270969 77/286 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1788..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1841..1899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.